SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007362 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007362
Domain Number 1 Region: 331-541
Classification Level Classification E-value
Superfamily TPR-like 1.26e-29
Family Tetratricopeptide repeat (TPR) 0.0071
Further Details:      
 
Domain Number 2 Region: 232-372
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000245
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007362
Domain Number - Region: 152-256
Classification Level Classification E-value
Superfamily TPR-like 0.00146
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007362   Gene: ENSPANG00000006158   Transcript: ENSPANT00000002459
Sequence length 597
Comment pep:known_by_projection chromosome:PapAnu2.0:6:131730143:131762930:-1 gene:ENSPANG00000006158 transcript:ENSPANT00000002459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTSVVPVAVTAAVAPVLSTNSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCDSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
Download sequence
Identical sequences A0A096N4N7 A0A2K5LAL8
ENSPANP00000007362 XP_011945787.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]