SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007364 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007364
Domain Number 1 Region: 192-261
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.32e-18
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007364   Gene: ENSPANG00000003278   Transcript: ENSPANT00000002463
Sequence length 834
Comment pep:known_by_projection chromosome:PapAnu2.0:6:128122274:128173913:1 gene:ENSPANG00000003278 transcript:ENSPANT00000002463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITA
MKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSS
TTLGEGSQPDWPGGSRYDLDEIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQ
NMARAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS
WLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS
HIPASRWALSCSLCKECTGTCIQCSMPSCVTAFHVTCAFDHSLEMRTILADNDEVKFKSF
CQEHSDGGPRNEPTSEPAEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEPAEVAERLDLA
EALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVR
NLCYMVTRRERTKHAICKLQEQIFHLQMKLIEQDLCRERSGRRAKGKKSDSKRKGCEGSK
GSTEKKEKVKAGPDSVLGQLAGLSTSFPIDGTFFNSWLAQSVQITAENMAMSEWPLNNGH
REDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRLPAKKKPPPPPPQDGPG
SRTTPDKAPKKTWGQDAGSGKGGQGPPTRKPPRRTSSHLPSSPTAGDCPILATPESPPPL
APETPDEAASVAADSDVQVPGPAASPKPLGRLRPPRESKVTRRLPGARPDAGMGPPSAVA
ERPKVSLHFDTETDGYFSDGEMSDSDVEAEDGGVQRGPREAGAEEVVRMGVLAS
Download sequence
Identical sequences A0A096N4N9 A0A2K5LV67 A0A2K6AF90
ENSPANP00000007364 XP_011824601.1.47321 XP_011945664.1.92194 XP_011945665.1.92194 XP_011945666.1.92194 XP_011945667.1.92194 XP_011945668.1.92194 XP_011945669.1.92194 XP_011945670.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]