SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007403 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007403
Domain Number 1 Region: 144-244
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.7e-33
Family GS domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 44-137
Classification Level Classification E-value
Superfamily TPR-like 1.49e-20
Family Tetratricopeptide repeat (TPR) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007403   Gene: ENSPANG00000025937   Transcript: ENSPANT00000014180
Sequence length 343
Comment pep:known_by_projection chromosome:PapAnu2.0:17:30731633:30779636:1 gene:ENSPANG00000025937 transcript:ENSPANT00000014180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQKFPPWAVVEVVTAIVATPAAATVTTRDGGGCSRNCNIPEELTKALEEKPDDAQYYCQ
RAYCHILLGNYCVAVADAKKSLKLNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDS
ADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFS
EKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGD
VPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSD
EVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Download sequence
Identical sequences ENSPANP00000007403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]