SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007416 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000007416
Domain Number 1	Region: 43-106
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.05e-17
Family	LIM domain	0.0014
Further Details:

Domain Number 2	Region: 166-227
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	4.28e-16
Family	LIM domain	0.002
Further Details:

Domain Number 3	Region: 224-287
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	5.88e-16
Family	LIM domain	0.0011
Further Details:

Domain Number 4	Region: 130-164
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000025
Family	LIM domain	0.00087
Further Details:

Domain Number 5	Region: 6-40
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000371
Family	LIM domain	0.0031
Further Details:

Domain Number 6	Region: 101-132
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000722
Family	LIM domain	0.0013
Further Details:

Weak hits

Sequence:	ENSPANP00000007416
Domain Number -	Region: 283-312
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0148
Family	LIM domain	0.024
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000007416 Gene: ENSPANG00000025527 Transcript: ENSPANT00000013039
Sequence length	341
Comment	pep:known_by_projection chromosome:PapAnu2.0:13:124863643:124902025:-1 gene:ENSPANG00000025527 transcript:ENSPANT00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTGSNMSDALANAVCQRCQARFTPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEG RKYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGR HLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEAREL KGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKK GLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFD MKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences	A0A2I3M329 A0A2K5KL91 XP_011929122.1.92194 ENSPANP00000007416

SEARCH