SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007436 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007436
Domain Number - Region: 279-334
Classification Level Classification E-value
Superfamily PX domain 0.00186
Family PX domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007436   Gene: ENSPANG00000023919   Transcript: ENSPANT00000008422
Sequence length 565
Comment pep:known_by_projection chromosome:PapAnu2.0:19:18324874:18326784:1 gene:ENSPANG00000023919 transcript:ENSPANT00000008422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLTRLLYHFRSESPGKNLLQEHEVLSLCGSRTQGLLEGVHGYSDCGLFPASSVIQDSK
LGLAGDGGPSISATANMLLGGFETMPGILPTSLRPLLPVLQLQHVSPLNTFQQPVQASDG
RGAQQPWPQQLFRGNQDSQGSDDAQDKWDGSSMMVDVPSGSSHLVLSGSLGSCGGNSLAT
MRRSLNRFPTCQVRQGGLVLGEVLGSVKDGDKLCMALWLYGLKWQENPYSFQCTTGDTTQ
QNRFKGMNSVLSCKLVTMHRQVPVHGATSTWTDWMRVGTLPAISVPHPPEKWATGCFQED
FISKHRKSLICGMSHTASCPVLQCHVLQHFLMCPSSTERRPGNKVMGGGWCEKGDMVGAS
SFLTLSTPPTALDLQEVESMIDSSICFLKKVDDPAAAQPQGMEFTKQVRGFEKEHQQGQP
SRSLSQALEWAQQGFWVGLKQPVTFTGGAYDAIVKLFPDWPRQDLDSVSDLLLLSKWQCI
KFPDVLHVHRGALTKVTGSRRLVGGGTMEVRGLMALRSWDMSSLATLAEIHHLHPIRGRD
LRSQMQHFLPEENNLEAALYKDESV
Download sequence
Identical sequences ENSPANP00000007436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]