SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007437 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007437
Domain Number - Region: 413-451
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000242
Family Erythroid transcription factor GATA-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007437   Gene: ENSPANG00000011632   Transcript: ENSPANT00000010631
Sequence length 634
Comment pep:known_by_projection chromosome:PapAnu2.0:19:17960537:18084060:1 gene:ENSPANG00000011632 transcript:ENSPANT00000010631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPAQGL
LRATEVTAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGL
TTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPT
GSVGSAVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASS
QVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNT
SLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTL
LEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAATVLSREPYMCAQ
CKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQ
GAAPAQAKAEPAAAPHPALKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPR
GVLHTFSPSPKLQNSASATALVSRTGRHSERTVSSGKGSATSNWKKTPLSTGGTLAFVSP
SLAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK
Download sequence
Identical sequences A0A2I3MAE8
ENSPANP00000007437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]