SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007476 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007476
Domain Number 1 Region: 319-549
Classification Level Classification E-value
Superfamily TPR-like 6.68e-23
Family Tetratricopeptide repeat (TPR) 0.07
Further Details:      
 
Domain Number 2 Region: 557-726
Classification Level Classification E-value
Superfamily TPR-like 1.68e-20
Family Tetratricopeptide repeat (TPR) 0.092
Further Details:      
 
Domain Number 3 Region: 92-183
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000157
Family HAT/Suf repeat 0.062
Further Details:      
 
Domain Number 4 Region: 25-78
Classification Level Classification E-value
Superfamily TPR-like 0.00000000199
Family HAT/Suf repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007476   Gene: ENSPANG00000023955   Transcript: ENSPANT00000016533
Sequence length 855
Comment pep:known_by_projection chromosome:PapAnu2.0:19:7277313:7288194:-1 gene:ENSPANG00000023955 transcript:ENSPANT00000016533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERA
LKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFL
MDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESA
EEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYA
QFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEW
HKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEK
ATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKA
YERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYA
QLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLS
DEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
KEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLA
AEAERDQPSRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLE
QQSVPAAVFGSLKED
Download sequence
Identical sequences A0A0A0MVR9 A0A0D9R7M5 A0A2K5UMY1 A0A2K5ZDW2 A0A2K6C5H1 H9FXD5
ENSPANP00000007476 XP_005587821.1.63531 XP_007993251.1.81039 XP_011744268.1.29376 XP_011837424.1.47321 XP_014978174.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]