SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007486 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007486
Domain Number 1 Region: 545-757
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000841
Further Details:      
 
Domain Number 2 Region: 93-364
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-32
Family FCH domain 0.06
Further Details:      
 
Domain Number 3 Region: 491-540
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007486   Gene: ENSPANG00000020293   Transcript: ENSPANT00000020608
Sequence length 974
Comment pep:known_by_projection chromosome:PapAnu2.0:19:18208829:18224502:-1 gene:ENSPANG00000020293 transcript:ENSPANT00000020608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPGLPPAPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPPLSEDPEPDKTPTATA
TNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSPEDPSP
QASPGPSKQQERRRRSREEAQAKALEAETLYQACVREANARQQDLEIAKQRIVSHVRKLV
FQGDEVLRRVTLGLFGLRGAQAEQGPRIFAALAECCVPFEPGQRYQEFVRALRPEPPPPP
PPAFSFQEFVPSVNSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPIPG
SDVDSVGGGSESRSLDSPTSSPGAGTRQLVKASSTGTESSDDFEERDPDLGDGLENGLGS
PFRKWTLSSAAQTHRLRRLRGPTKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHR
RLPARTPLFGVDFLQLPRDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQ
AFENGRALVELSGNSPHDVSSVLKRFLQELTDPVIPFHLYDAFISLAKTLHADPGDDPGT
PSPSPEVICSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLR
PPDSPRAAGAIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPL
TASSQPPPLDLDPDSQPPVLASDPGLDPGPDPQPHSALEQHPTATPTEIPTPQSDQREDV
AEGTKDGGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCE
ETPITSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLDSEAVPRAT
CCPDVQPEEAEDHL
Download sequence
Identical sequences ENSPANP00000007486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]