SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007493 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007493
Domain Number 1 Region: 193-271
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-28
Family Homeodomain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007493
Domain Number - Region: 90-123
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000785
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007493   Gene: ENSPANG00000023497   Transcript: ENSPANT00000028084
Sequence length 409
Comment pep:known_by_projection chromosome:PapAnu2.0:14:20851871:20896763:1 gene:ENSPANG00000023497 transcript:ENSPANT00000028084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDA
KNRARYSAGQQDLATPLESGAGARGSFNKFQHQPSTPQPQPPPQPQQQQPQPQPPAQPHL
YLQRGACKTPPDGSLKLQEGSSGHNAALQIPCYAKESSLGEPELPPDSDTVGMDSSYLSV
KEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVY
AREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQ
IQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFLSVSGAGSHVGQT
HMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT
Download sequence
Identical sequences A0A096N4Y9
ENSPANP00000007493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]