SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007504
Domain Number 1 Region: 12-120,316-395
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.76e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 
Domain Number 2 Region: 148-181,259-358
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000169
Family Siroheme synthase N-terminal domain-like 0.042
Further Details:      
 
Domain Number 3 Region: 126-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000194
Family FAD/NAD-linked reductases, N-terminal and central domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007504   Gene: ENSPANG00000020209   Transcript: ENSPANT00000022539
Sequence length 503
Comment pep:known_by_projection chromosome:PapAnu2.0:11:20932029:20966490:1 gene:ENSPANG00000020209 transcript:ENSPANT00000022539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARPPATAGKFVVVGGGIAGVTCAEQNKLATQFPSEDILLITASPVIKAVTNFKQISK
ILEEFDVEEQSSTMLEKRFRNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKP
KLICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDK
AIGNTFFDAGAAEFLTSKLIAEKPEAKIAQKRTRYTTEGRKKEARSKSKADNVGSALGPD
WHEGLNLKGTKEFSHRIHLETMCEVKKIYLQDEFRILKKKSFTFPRDPKSVTTDTEEMWP
VYVELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFNLGEDGGLKVDDHMHTSLPDVYAAG
DICTASWQLSPVWQQMRLWTQARQMGWYAAKCMAAASLGDSIDMDFSFELFAHVTKFFNY
KVVLLGKYNAQGLGSDHELMLRCTKGQEYIKVVMQNGRMMGAVLIGETDLEETFENLILN
QMNLSSYGEDLLDPNIDIEDYFD
Download sequence
Identical sequences ENSPANP00000007504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]