SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007505 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000007505
Domain Number 1	Region: 116-145
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000437
Family	LIM domain	0.01
Further Details:

Domain Number 2	Region: 80-112
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000108
Family	LIM domain	0.0034
Further Details:

Domain Number 3	Region: 50-80
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000476
Family	LIM domain	0.0091
Further Details:

Weak hits

Sequence:	ENSPANP00000007505
Domain Number -	Region: 146-176
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00784
Family	LIM domain	0.035
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000007505 Gene: ENSPANG00000010278 Transcript: ENSPANT00000012618
Sequence length	187
Comment	pep:known_by_projection chromosome:PapAnu2.0:11:16273194:16326928:-1 gene:ENSPANG00000010278 transcript:ENSPANT00000012618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MYACLDGPEKPNLRNLPMYRTSQLRGSHYSTVSEYRYFSGIQMLSVQPDTKPKGCAGCNR KIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCA ACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKE GYAPQVR
Download sequence
Identical sequences	XP_005570312.1.63531 XP_007965972.1.81039 XP_011739443.1.29376 XP_011830826.1.47321 XP_015006589.1.72884 ENSPANP00000007505

SEARCH