SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007509 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007509
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-55
Family Necap1 N-terminal domain-like 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007509   Gene: ENSPANG00000009521   Transcript: ENSPANT00000006378
Sequence length 275
Comment pep:known_by_projection chromosome:PapAnu2.0:11:8180686:8196538:1 gene:ENSPANG00000009521 transcript:ENSPANT00000006378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWVKQESEISKESQEMDARPKLDLGFKEGQTIKLSIGNITTKKGGASKPRTAR
GGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTP
APTPVSASNDLWGDFSTASSSVPNQAPQPSNWVQF
Download sequence
Identical sequences A0A096N505 A0A0D9RBK2 A0A2K5K798 A0A2K6JMY7 A0A2K6RGV1
ENSPANP00000007509 XP_007965681.1.81039 XP_010375033.1.97406 XP_011808962.1.43180 XP_017749775.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]