SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Papio anubis 76 > ENSPANP00000007543

Domain assignment for ENSPANP00000007543 from Papio anubis 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPANP00000007543
Domain Number 1	Region: 157-298
Classification Level	Classification	E-value
Superfamily	cAMP-binding domain-like	2.49e-35
Family	cAMP-binding domain	0.00000177
Further Details:

Domain Number 2	Region: 23-153
Classification Level	Classification	E-value
Superfamily	cAMP-binding domain-like	6.15e-33
Family	cAMP-binding domain	0.000000843
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPANP00000007543 Gene: ENSPANG00000012986 Transcript: ENSPANT00000011275
Sequence length	307
Comment	pep:known_by_projection chromosome:PapAnu2.0:2:86536843:86576360:1 gene:ENSPANG00000012986 transcript:ENSPANT00000011275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	ILVCAETYNPDEEEEIQDWQVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFE RIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPR AATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVI GEKIYKDGERIITQGEKADSFYIIESGEVSILIRSKTKSNKDGGNQEVEIARCHKGQYFG ELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSM DLGNLGQ
Download sequence
Identical sequences	ENSPANP00000007543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]