SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007559 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007559
Domain Number 1 Region: 275-395,445-468
Classification Level Classification E-value
Superfamily TPR-like 1.14e-26
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Domain Number 2 Region: 198-313
Classification Level Classification E-value
Superfamily TPR-like 4.34e-24
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007559
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0262
Family N-terminal coiled coil domain from apc 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007559   Gene: ENSPANG00000012186   Transcript: ENSPANT00000003894
Sequence length 622
Comment pep:known_by_projection chromosome:PapAnu2.0:14:7835046:7843415:-1 gene:ENSPANG00000012186 transcript:ENSPANT00000003894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMMVLPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCIL
LRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKL
QRSEQAVAQLEEEKQHLLFMSQIRKLDEDTSPNEEKGDVPKDTLDDLFPNEDEQSPAPSP
GGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVA
TMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE
AEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGP
DDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRK
QGLDPASQTKVVELLKDGSGGRGDRRGSRDVAGGAGPRSESDLEDAGPTAEWSGDGSGSL
RRSGSFGKLRDALRRSSEMLVKKLQGGGPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTG
LSDSRTLSSSSMDLSRRSSLVG
Download sequence
Identical sequences A0A2K5MQJ6
ENSPANP00000007559 XP_011896985.1.92194 XP_011896986.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]