SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007618 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007618
Domain Number 1 Region: 12-220
Classification Level Classification E-value
Superfamily t-snare proteins 2.35e-48
Family t-snare proteins 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007618   Gene: ENSPANG00000019776   Transcript: ENSPANT00000027648
Sequence length 261
Comment pep:known_by_projection chromosome:PapAnu2.0:4:130046753:130098697:1 gene:ENSPANG00000019776 transcript:ENSPANT00000027648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTASLTNFQKVQRQAAEREKEFVA
RVRASSRVSGGFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGAVIIGLIIWGLNR
Download sequence
Identical sequences A0A096N5A9 A0A0D9RVT9 A0A2K5M8Q5 A0A2K5ZDE4 A0A2K6BUW2 A0A2K6KK55 A0A2K6NZI5 F7ATP9 I7G8H7
ENSMMUP00000006615 NP_001244653.1.72884 NP_001270370.1.63531 XP_008005209.1.81039 XP_010356201.1.97406 XP_011712451.1.29376 XP_011829504.1.47321 XP_011947068.1.92194 XP_011947069.1.92194 XP_011947070.1.92194 XP_017735080.1.44346 ENSMMUP00000006615 ENSPANP00000007618 9544.ENSMMUP00000006615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]