SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007620 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007620
Domain Number 1 Region: 548-673
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 83-263
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000106
Family HspBP1 domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007620   Gene: ENSPANG00000022520   Transcript: ENSPANT00000007524
Sequence length 727
Comment pep:known_by_projection chromosome:PapAnu2.0:3:73704361:74276039:1 gene:ENSPANG00000022520 transcript:ENSPANT00000007524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLPNHEYYALQHADSSNFY
ITEKNRNEIKNGTILRLTKSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDDRRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
Download sequence
Identical sequences A0A096N5B1 A0A0D9RRB5 A0A2K5TXT2 A0A2K5YZU2 A0A2K6ARS9 F7DM33
ENSMMUP00000030417 ENSMMUP00000035235 NP_001244576.1.72884 XP_005549840.1.63531 XP_005549841.1.63531 XP_005549842.1.63531 XP_007979786.1.81039 XP_007979787.1.81039 XP_007979788.1.81039 XP_011767439.1.29376 XP_011767441.1.29376 XP_011767442.1.29376 XP_011828271.1.47321 XP_011828281.1.47321 XP_011828286.1.47321 XP_014989195.1.72884 XP_014989196.1.72884 XP_015303008.1.63531 ENSPANP00000007620 9544.ENSMMUP00000030417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]