SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007622 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007622
Domain Number 1 Region: 1299-1441
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-41
Family Phosphotyrosine-binding domain (PTB) 0.0000083
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.92e-39
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 3 Region: 7-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.11e-28
Family Dual specificity phosphatase-like 0.00045
Further Details:      
 
Domain Number 4 Region: 1165-1286
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007622   Gene: ENSPANG00000021643   Transcript: ENSPANT00000003365
Sequence length 1447
Comment pep:known_by_projection chromosome:PapAnu2.0:3:63912301:64072336:1 gene:ENSPANG00000021643 transcript:ENSPANT00000003365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLMIIFNSKIWE
NFKLSPQIMDVGWPELHAPPLDKMCTICKAQESWLNSDPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFL
HFVILHGTPNFDTGGVCRPFLKLYQAMQPVYTSGIYNVGPENPSRICIVIEPAQLLKGDV
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKDDRFPDYGKVELVFSA
TPEKIQGSEHLYNDHGVIVDYNTADPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKK
SSSDPGIPGGPHTVPTTNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQ
EKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDD
EMPHHDLHSVDSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGNNVGEDPQGTLVPD
LGLGMDGPYERERTFGSREPKQPQPLLRKPSVSSQMQAYGQSSYSTQTWVRQQQMVVAHQ
YSFAPDGEARLVSRGPADNPGLVQAQPRVPLTPTRGTSSRVAVQRGVGSGPHPSDTQQPS
PSKAFKPRFPGDQVMNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHM
NALGSQANGSVSPDSVGGGLRASSRLPDTGEGPNRAPGRQGSSPEQPLGGRLRKLSLGQY
DNDTGGQLPFSKCAWGKAGVDHAPNLPPFPSPADVKETMTPGYPPDLDMIDGRILSSKES
MCSTPAFPVSPETPYVKTAPRYPPFSPPEPTLSSPASQHKGGREPRGCPETLSHTVGMSE
SPIGPKSMMLRADAPSTPSFQQAFASSCTVSSNSPGQRREGSSSAERQWVESSPKPTVSL
LGSGRPTGSPLSAELSGTRKDSPVLSCFPPSELQASFHSHELSLAEPPDSLAPPSSQTFL
GFGTAPVGSGLPPEEDLGALLANSHGVSPTPGIPLTATGAADNGFLSHNFLTVAPGHSSH
HSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSGFSSPHSGSTISIPFPNVLPD
FSKASEVASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSH
SFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSL
TALVCQHSITPLALPCKLLIPERDPLEEIAENSPQTAANSAAELLKQGAAHNCRVVYKCN
STIKKFIHHCVCYPAKSIFLAQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSV
IFCALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVM
IGSPKKV
Download sequence
Identical sequences ENSPANP00000007622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]