SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007624 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007624
Domain Number 1 Region: 38-294
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-36
Family Calpain large subunit, catalytic domain (domain II) 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007624
Domain Number - Region: 784-853
Classification Level Classification E-value
Superfamily Globin-like 0.000545
Family Globins 0.011
Further Details:      
 
Domain Number - Region: 625-659
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00125
Family Calpain large subunit, catalytic domain (domain II) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007624   Gene: ENSPANG00000016096   Transcript: ENSPANT00000008518
Sequence length 1667
Comment pep:known_by_projection chromosome:PapAnu2.0:4:115868551:116101189:-1 gene:ENSPANG00000016096 transcript:ENSPANT00000008518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQTKKKEVHRINSAHGSDKSKDFYLFGSNVQPGSIEQKKGKFPIWPEWSEADINSEK
WDAGKGAKEKDKTGKSPVFHFFEDPEGKIELPPSLKIYSWKRPQDILFSRTPVVVKNEIT
FDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKGTSGEPPLLPWKPWEHIYSL
CKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLL
SKAIIKLANNDIHVADRRELGEFTVVHALTGWLPEVISLHPGYMDKVWELLKEILPEFKL
SDEASSESKLAVLDSKLKEPGKEGKEGKEIKDGKEIKDVKEFKPESSLTTLKASEKSDKV
PKEKADARDIGKKRSKDGEKEKFKFSLHGSRPSSEVQYSVQSLSDCSSAIQTSHMVVYAT
FTPLYLFENKIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPVPPWK
LIRQKKETVITDEAQELIVKKPEQFLEISSPFLNYRMTPFTIPTETHFVRSLIKKGIPPG
SDLPSVSETDETAMHSQTDLNQIAKATSQGNAASQVILGKGTEEQTDFGLGDAHQSDGLN
LERDIVSQTTETQEKSQEELPMTNNGVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQK
SEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGALTKDSPPIEPGLLTAETFSWK
SLKPGNLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGHAIHICSMVSFVIGDEHVVLP
NFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSAALKDLQTAHYPVPFHDKELTAQHFR
VFHLSLWRLMKKAQITKPPPNFKFAFRAMVLDLELLNSSLEEVSLVEWLDVQYSMPTCDK
EYSPEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAILEMNLEQYAVS
LXXLMFKSKCKSLESYPCYQDEETKIALADYTVTYQEQPPNSWFIVFRETFLVPQDMILV
PKVYTTLPICILHVVNNDTMEQVPKVFQKVVPYLYTKNKKGYTFVAEAFTGDTYVTASRW
KLRLIGSSAPLPCLSRDSPCNTFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTS
KPDAFIKLQVLENEETMVSSVGKGQAIIPAFNFLKSEKGLSSQSSKHILSFHSASKKDQE
VYVKKKAAQGIQKSPKGRAVSAIQDIGLPLLEEETTSTPTTEDSSSTLPQNYKYIIQCSV
LYNSWPLTESQLTFVQALKDLKKNNTKAYGERHEELITLGSPDSHTISEGQKSSVTSKIT
RKGKEKSSEKEKTAKEKQAPRFEPQISTVHPQQEDPNKPYWILRLVTEHSESELFEVKKD
TERADEIRAMKQAWETAEPGRAIKASQARLHYLSGFIKKTSDAESPPISESQTKPKEEVE
TAASGVKEPNSKNSAGSESKEMTQTGSGSVAWKKWQLTKSLRDVAKSTSSESGGASSPGK
EEREQSTRKENIKTGPRTRSPTILETSPRLIRKALEFMDLSQYVRKTDTDPLLQTDELNQ
QQAMQKAEEIHQFRQYRSRVLSIRNIDQEEQLKLKEEVLDMYKEMRDSLDEARQKIFDIR
EEYRNKLLEAERLKLEALAAQEAAMKLETEKKTPAPDKQKKKKGKKK
Download sequence
Identical sequences ENSPANP00000007624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]