SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007660 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007660
Domain Number 1 Region: 124-298,387-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.76e-44
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007660   Gene: ENSPANG00000005609   Transcript: ENSPANT00000013077
Sequence length 574
Comment pep:known_by_projection chromosome:PapAnu2.0:8:120037551:120060329:1 gene:ENSPANG00000005609 transcript:ENSPANT00000013077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVTLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQRSG
SQFALFSDILSALPFIGFFWAKSPPESENKEQLEARRRRKGTNISETTLIGAAASTSTSS
QNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL
GDTVEGLDAQAVNGYMIHDQESKSEVQIPFPLSENNQVQSGRAFHHGRFIMSLRKAAMAE
PNAKFIEGVVLQLLEEDDAVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLISNKV
SVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDVRGEMPRNLREYM
VEKIYPQIPDHLKEPFLEATENSRLRSMPASFLPPSSVNKRGVLLLGDAYNMRHPLTGGG
MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWERKASHSFVVNILAQALYELFSAT
DDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAVYAIYFCFKSEPW
ITKPRALLSSGAVLYKACSVIFPLIYSEMKYMVH
Download sequence
Identical sequences A0A096N5E7 A0A0D9RCQ9 A0A2K6D2Q5 Q2PFM6
NP_001274657.1.63531 XP_007999700.1.81039 XP_011716957.1.29376 ENSPANP00000007660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]