SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007665 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007665
Domain Number 1 Region: 328-603
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.48e-79
Family Mitochondrial carrier 0.0000459
Further Details:      
 
Domain Number 2 Region: 12-157
Classification Level Classification E-value
Superfamily EF-hand 1.57e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 3 Region: 159-289
Classification Level Classification E-value
Superfamily EF-hand 0.0000000391
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007665   Gene: ENSPANG00000000583   Transcript: ENSPANT00000026202
Sequence length 675
Comment pep:known_by_projection chromosome:PapAnu2.0:3:105710157:105885593:1 gene:ENSPANG00000000583 transcript:ENSPANT00000026202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCSSKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGNRKDVEVTKEEFVLAAQKFGQVTPMEVDILFRLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFKKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVPTSEAIGGGP
Download sequence
Identical sequences ENSPANP00000007665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]