SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007667 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007667
Domain Number 1 Region: 756-881
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.8e-27
Family Synaptotagmin-like (S variant) 0.0096
Further Details:      
 
Domain Number 2 Region: 1212-1317
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-23
Family Synaptotagmin-like (S variant) 0.0095
Further Details:      
 
Domain Number 3 Region: 1421-1578
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.11e-18
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 4 Region: 18-94
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000848
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 5 Region: 933-1052
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000039
Family PLC-like (P variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007667   Gene: ENSPANG00000001068   Transcript: ENSPANT00000004916
Sequence length 1721
Comment pep:known_by_projection chromosome:PapAnu2.0:13:70422822:70586243:1 gene:ENSPANG00000001068 transcript:ENSPANT00000004916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFP
SMCEKMRIRVIDWDRLTHNDIVATADLSMSKISAPGGDIEEETAGAVKPSKASDLDDHLG
FLPTFGPCYINLYGSPREFTGFLDPYAELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVE
DSADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLAST
TQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHL
ALKAQCSTEDVDSLVAQMMDELIAGCSQPLGDIHEIPSATHLDEYLYRLRTRHLSQITEA
ALALKLGHSELPAALDQAEDWLLRLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHQV
LFSRRGANYCGKNCGKLQTIFLKYPMEKVPGARMPVQIRVKLWFGLSVDEKEFNQFAEGK
LSVFAETYENQTKLALVGNWGTTGLTYPKFSDVTGKIKLPKESFRPSAGWTWAGDWFVCP
EKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKW
EDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQME
ALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEG
ALGGVVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSD
PYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTY
GADEFMGRCICQPSLERTPRLAWFPLTKGSQPTGELLASFELIQREKPAIHHIPGFEVQE
TSRILDELCAPAFFLQGLLQTSEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEVLAWG
LRNMKSYQLASISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPP
ITIKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI
DDKEPLIPIQLADGLSSLAPTNTASPPSSPHEEEFIDWWSKFFASIGEREKCGSYLEKDF
DTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPA
IPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYI
PCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDLLSKDEKIGETVIDLENRLLSKFAARCG
LPQTYCVSGPNQWRDQLRPSQLLHLFCQQRRVKAPVYRTDRVMFQDKEYSIEEIEAGRIP
NPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGP
PFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYR
SLGGEGNFNWRFIFPFDYLPAEQICTVAKKDAFWRLDKTESKIPARVIFQIWDNDKFSFD
DFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVAEEGEKK
ILAGKLEMTLEIVTESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFIL
WRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLVKPFS
Download sequence
Identical sequences ENSPANP00000007667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]