SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007679 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007679
Domain Number 1 Region: 99-433
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-86
Family Protein kinases, catalytic subunit 0.0000000000127
Further Details:      
 
Domain Number 2 Region: 466-575
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-24
Family Pleckstrin-homology domain (PH domain) 0.00000453
Further Details:      
 
Domain Number 3 Region: 1-96
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.37e-23
Family Regulator of G-protein signaling, RGS 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007679   Gene: ENSPANG00000011721   Transcript: ENSPANT00000003920
Sequence length 600
Comment pep:known_by_projection chromosome:PapAnu2.0:10:66103614:66262300:1 gene:ENSPANG00000011721 transcript:ENSPANT00000003920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQP
YIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGC
RKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLC
FILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEH
GHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGH
SPFRQHKTKDKHEIDRMTLTVNVELPDTFSPELKSLLEGLLQRDVSKRLGCHGGGSQEVK
EHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYKN
FPLVISERWQQEVTETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKL
GNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGK
QFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL
Download sequence
Identical sequences ENSPANP00000007679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]