SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007684 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007684
Domain Number 1 Region: 992-1089
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000285
Family Canonical RBD 0.0068
Further Details:      
 
Domain Number 2 Region: 72-109
Classification Level Classification E-value
Superfamily SAP domain 0.00000256
Family SAP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007684   Gene: ENSPANG00000019644   Transcript: ENSPANT00000020321
Sequence length 1339
Comment pep:known_by_projection chromosome:PapAnu2.0:7:79708274:79746614:-1 gene:ENSPANG00000019644 transcript:ENSPANT00000020321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRRKYPRTSGGSRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVA
SLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLS
EGSQPGEEEEDQETPSRNLRVRAERNLKTEEEEEEEEEEEEDEEEEDDDEGQKSREAPIL
KEFKEEGEEMPRVKPEEMMDERPKTRSQEQEVLERGGRVTRSQEEARKSHLARQQQEKEM
KTSPLEEEEREIKSAQGLKEKSKSPSPPRLTEDLKKAPLVVQPEQTASEEETPPPLLTKE
ASSPPPHIQLRSEEEIEPMEGPAPPVLIQLSPPNTDAETRELLVSQHTVQLVGGLSPLSS
PADTKAESPAEKVPEESVLPLVQKSTLADYSAQKDLEPESDKSAQPLPLKIEELALAKGI
TEECLKQPSLEQKEGRRASHTFLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSGSR
SHSPLRSTQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASSNSRKSLSPGVSR
DSSTSYTETKDPPSGQEVATPPVPQLQVREPKERTSTSSSSVQARRLSQPEPAEKRVTQR
LQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENRPE
NDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEG
GQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDET
ERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPP
PAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRP
FTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFL
CADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAV
REQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKA
QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKE
REKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTK
RHSRSRSRSTPVRDRGGRR
Download sequence
Identical sequences A0A096N5H1
ENSPANP00000007684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]