SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007717 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007717
Domain Number 1 Region: 285-346
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000778
Family UBA domain 0.0097
Further Details:      
 
Domain Number 2 Region: 14-194
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000157
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007717   Gene: ENSPANG00000023958   Transcript: ENSPANT00000014296
Sequence length 346
Comment pep:known_by_projection chromosome:PapAnu2.0:17:76594625:76742583:1 gene:ENSPANG00000023958 transcript:ENSPANT00000014296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLHLGSHFLKDKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLIC
GRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLVEAMQYFFG
ITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYI
WIVAISGLMSGLCYNSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATL
DIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPA
APPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences ENSPANP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]