SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007720 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007720
Domain Number 1 Region: 168-343
Classification Level Classification E-value
Superfamily Rhomboid-like 1.05e-30
Family Rhomboid-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007720   Gene: ENSPANG00000011016   Transcript: ENSPANT00000008517
Sequence length 365
Comment pep:known_by_projection chromosome:PapAnu2.0:2:101659722:101718179:1 gene:ENSPANG00000011016 transcript:ENSPANT00000008517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRGWAQRGWGCGQAWAVSVDGRSCEELTAALAPQRLLGRRFNFFIQQKCGFRKAPRKV
EPRRSDTGTSGEAYRRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQ
YESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVF
CLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNIL
GQEQFMALYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIF
LPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGMKQGPESFLTPSLLHLPL
CSRSP
Download sequence
Identical sequences ENSPANP00000007720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]