SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007723 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007723
Domain Number 1 Region: 3909-4100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-39
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 4163-4365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-37
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 3 Region: 1641-1657,3665-3845
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.93e-33
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 405-490
Classification Level Classification E-value
Superfamily Immunoglobulin 3.53e-21
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 3572-3660
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 1955-2043
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 3298-3387
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 3211-3303
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-19
Family I set domains 0.0076
Further Details:      
 
Domain Number 9 Region: 2050-2136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-18
Family I set domains 0.037
Further Details:      
 
Domain Number 10 Region: 1676-1771
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 3495-3578
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 12 Region: 1774-1859
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-16
Family I set domains 0.000028
Further Details:      
 
Domain Number 13 Region: 3022-3117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 14 Region: 3108-3202
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 15 Region: 2435-2522
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 16 Region: 2628-2716
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 17 Region: 2537-2621
Classification Level Classification E-value
Superfamily Immunoglobulin 8.78e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 18 Region: 2245-2326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000278
Family I set domains 0.057
Further Details:      
 
Domain Number 19 Region: 2154-2237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000389
Family I set domains 0.064
Further Details:      
 
Domain Number 20 Region: 2730-2816
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000404
Family I set domains 0.068
Further Details:      
 
Domain Number 21 Region: 2924-3009
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000446
Family I set domains 0.072
Further Details:      
 
Domain Number 22 Region: 1865-1952
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000816
Family I set domains 0.046
Further Details:      
 
Domain Number 23 Region: 3400-3491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000112
Family I set domains 0.021
Further Details:      
 
Domain Number 24 Region: 2826-2912
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000124
Family I set domains 0.035
Further Details:      
 
Domain Number 25 Region: 2343-2429
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000075
Family V set domains (antibody variable domain-like) 0.094
Further Details:      
 
Domain Number 26 Region: 1563-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 27 Region: 367-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 322-360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 29 Region: 282-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 30 Region: 764-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 31 Region: 1159-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 32 Region: 824-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 33 Region: 3841-3882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family EGF-type module 0.014
Further Details:      
 
Domain Number 34 Region: 194-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 1622-1670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 36 Region: 4105-4148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000015
Family EGF-type module 0.012
Further Details:      
 
Domain Number 37 Region: 1219-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007723
Domain Number - Region: 1275-1322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00023
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number - Region: 887-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000431
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 1122-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00194
Family Laminin-type module 0.092
Further Details:      
 
Domain Number - Region: 1528-1565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 725-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0171
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 1398-1444
Classification Level Classification E-value
Superfamily PEP carboxykinase N-terminal domain 0.068
Family PEP carboxykinase N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007723   Gene: ENSPANG00000008046   Transcript: ENSPANT00000021571
Sequence length 4391
Comment pep:known_by_projection chromosome:PapAnu2.0:1:24050744:24168162:-1 gene:ENSPANG00000008046 transcript:ENSPANT00000021571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRATGALLLALLLHGRLLAVTHGLSAYDGLSLPEDTETVTASQMRWTHSYLSDDEDML
ADSTSGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGTQIQEVLLRVISSGSMASYITS
PRGFQFRRLGTVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEELVLG
ISPTVSLLMETTPLPPRPETAIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRSGHCIPR
DYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCS
TKRPEEVCGPTQFRCVSTNVCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQESIQASR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCE
AMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSASCLPCFCFGITSVCQSSRRFRDQI
RLHFDQPDDFKGVNVVMPAQPSMPPLSSTQLQIDPALHEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQR
QVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHAT
SHGRAHGVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSVGTSGEACRCKNNVVG
RLCNECADGSFHLSTQNPDGCLKCFCMGVSRQCTSSSWSRAQVHGASEEPGHFSLTNAAS
TYTTNEGIFSSAPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPG
STPLHGQPLVVLQGNNIILEHHPAQEPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMA
LAGIDTLLVRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDC
DTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQR
GTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQG
QPCRRDGQVPGPIGCNCDPQGSVSSQCDTAGQCQCKAQVEGLTCSHCRPHHFHLNASNPE
GCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGA
QLSFGNFAHLGHESFYWQLPETYQGDKVAAYGGKLRYTVSYTAGPQGSPLSDPDVQITGN
NIMLVASQPALQGTERRSYEIVLREEFWRRPDGQPATREHLLMALTDLDELLIRATFSSV
PLAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYIGLSCQDCAAGYTRTGSGLYLGHC
ELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPSVQGGRCLPETNQAPLVVE
VHPARSVVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSSTQQRHQGSELHFPSVQPSD
AGVYICTCRNLHHANTSRAELLVTEAPSKPITVTVEEQRSQSVRPGTDVTFICTAKSKSP
AYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
GTSSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIRGGILRL
PAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGSGPRVQVSPERTQVHEGRTVRLYCRAA
GVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQV
VVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGS
RLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTQPIRIEPSS
SHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCRV
VGTSGPLEASVLVTIEASVIPGRVPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGST
QPVRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQVSPA
DSGEYVCRVAGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSHVAEGQTLDLNCLV
AGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTI
QQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQI
VGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPT
VVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANN
NIDALEASIVISVSPRAGSPSAPGSSMPIRIESSSSHVAEGQTLDLNCMVPGQAHAQVTW
HKRGGSLPSHHQAHGSRLRLHQVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHV
PAPGGAPPIRIETSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRL
NQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQ
TLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHQVSPADSGEYVCRAAGGPGPE
QEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAVPISLEWKTRN
QELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEG
PVWVKVGKAVTLECVSAGEPRSSARWTRISSAPAKLEQRTYGLMDSRAVLQISSAKPSDA
GTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPA
PTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPY
ATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDS
GRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFH
CAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQASAQ
LVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVV
RIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASG
YPTPDISWSKLDGSLPPDSRLENNMLTLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPE
RVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRVPGSPTNLANRQ
PDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVN
GTSQGKFQGLDLNEELYLGGYPDYGAIPKVGLSSGFIGCVRDLRIQGEEIIFHDLNLTAH
GISHCPTCRDRPCQNGGQCHDSESSSYMCVCPAGFTGSRCEHSQALHCHPEACGPDATCV
NRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPL
APDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAER
LNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEV
SVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLC
EHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPG
QYGAYFHDDGFLAFPGRIFSRSLPEVPETIELEVRTSTANGLLLWQGVEVGEAGRGKDFI
SLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSP
GPNVAVNAKGSVYIGGAPDVTMLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRA
QAGANTRPCPS
Download sequence
Identical sequences ENSPANP00000007723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]