SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007750 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007750
Domain Number 1 Region: 382-795
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.09e-109
Family Phosphofructokinase 0.00000789
Further Details:      
 
Domain Number 2 Region: 92-380
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-95
Family Phosphofructokinase 0.000000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007750   Gene: ENSPANG00000019403   Transcript: ENSPANT00000018782
Sequence length 822
Comment pep:known_by_projection chromosome:PapAnu2.0:11:43848979:43893393:1 gene:ENSPANG00000019403 transcript:ENSPANT00000018782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEGAMHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPTKTDTLKSLDTL
DDPDTVRSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIF
TGARVFFVHEGYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAY
NLKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQS
HQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLN
IIIVAEGAIDRNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGV
EAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMEEKKFDEALKLRGRSF
MNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHD
GFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGG
FEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQ
SAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKT
TVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATK
MGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALLFQPVTELQGQTDFEHRIPK
EQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEGAV
Download sequence
Identical sequences F6WXS8
ENSPANP00000007750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]