SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007754 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007754
Domain Number 1 Region: 1057-1278
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.23e-81
Family Fibrinogen C-terminal domain-like 0.00000154
Further Details:      
 
Domain Number 2 Region: 621-788
Classification Level Classification E-value
Superfamily Fibronectin type III 5.81e-21
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 3 Region: 444-604
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 798-959
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-20
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 5 Region: 264-426
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 971-1059
Classification Level Classification E-value
Superfamily Fibronectin type III 5.56e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007754
Domain Number - Region: 237-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 174-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 205-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family Integrin beta EGF-like domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007754   Gene: ENSPANG00000005095   Transcript: ENSPANT00000004555
Sequence length 1299
Comment pep:known_by_projection chromosome:PapAnu2.0:1:197706508:197769090:1 gene:ENSPANG00000005095 transcript:ENSPANT00000004555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQEMFRFPLGLLLGSVLLVASAPATLEPPSCNNKEQQVTVSHTYKIDVPKSALVQVEA
DPQPLSDDGASLLALGEAGEEQNIVFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAQRCCQGATDLSRRCSGHGTFSLETCSCHCEEGREGPACEQLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFASEDCSERRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVAPQGLQLLKSTEDSLLVSWEPSSQVDHYFLNYYPLGK
ELSGKQIRVPKEQHSYKILGLLPGTKYIVTLRNVKKDIFSSPQHLLATTDLAALGTAWVT
EETEHSLDVEWENPSTEVDYYKLRYGPMTGQEVTEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGMLEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWEPVQAVIDKYVVRYTSA
DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSADNQETREVPVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKANTNAPTDIDSPKNLVTDQVTENMATVSWDPVQATIDKYMVRYTSADGE
TREVPVGKEHSSTILTGLRPGMEYMVHVWAQKGDQESKKTDTKAQTDIDSPQNLVTDWVT
ENVATVSWDPVQATIDRYVVRYTSAKDGETREVPVGKERNSTVLTGLRPGVEYTVHVWAQ
KGAQEGKKADTKAQTDIDSPKNLVTDRVTENTATVSWDLVQATIDRYVVRYTSANGETRE
VPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADTKAQTEIDSPKNLVTDRVTENM
ATVSWDPVQATIDKYVVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGDQ
ESKKTDTKAQTEIDPPRNLRPSAVTQSGGVLTWTPPSAQIHGYILTYQFPDGTVKEIQLG
REDQRFELQGLEQGATYPVSLVAFKGGLRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRTYVEGFGDPTKEF
WLGLDKLHNLTTGTPTRYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALSYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSKEPVLGRKKRTLGGRLRTF
Download sequence
Identical sequences A0A096N5P1
ENSPANP00000007754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]