SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007760 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007760
Domain Number 1 Region: 1158-1454
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000218
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007760
Domain Number - Region: 520-711
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0136
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007760   Gene: ENSPANG00000021916   Transcript: ENSPANT00000009075
Sequence length 1606
Comment pep:known_by_projection chromosome:PapAnu2.0:2:87964605:87999205:-1 gene:ENSPANG00000021916 transcript:ENSPANT00000009075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKFNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQ
LMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQT
GATSVPSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAAL
PTPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKK
LFEEQLKKYDQLKVYLEQNLAAQDRVLRALTEANVQYAAVRRVLSDLDQKWNSTLQTLVA
SYEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRP
TAPKPLLPRREESEAMEAGDPPEELRSLPPDMVAGPRLPDTFLGTATPLHFPPSPFPSST
GPGPHYLSGPLPPGTYSGPTQLIQPRAPGPAAMPVAPGPALYPAPAYTPELGLVPRSSPQ
HGVVSSPYVGVGPAPPVAGLPSAPPPQFSSPELTMVVRPATTTVDSIQAPIPSHTAPRPN
PTTAPPQPCFPVPPPQSLPTPYTYPVGTKQPVPAQHHFSPGIPAGFPAPRIGPQPQPHPS
RAFGPQPPQQPLPLQHPHLFPPHAPGLLPPQSPYPYAPQPGVLGQPPTPLHTQLYPGPAQ
DPLPAHSGALPFPSPGPPQPPHPPLAYGPAPSARPVGPQAAPLTIRGPSPAGQPTPSPHL
VPSPAPSPGPGSVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGSTQPPGGGQPLLQPT
KVDAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQDAQEH
DARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQA
PLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVR
STETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLHFIQEVHAHYLHQRPL
HTPIVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHLRF
CYEAVVRHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQATIAK
LSIRPPGGLESPVASLPGPAEPPGLPPASLPESVPEAPSSGPPSSSLELLASLTPEAFSL
DSSLRGKQRMSKQNFLQAHNGQGLRATQPSDDPLSLLDPLWTLNKT
Download sequence
Identical sequences ENSPANP00000007760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]