SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007779 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007779
Domain Number 1 Region: 426-486
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000391
Family PHD domain 0.0076
Further Details:      
 
Domain Number 2 Region: 372-436
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000329
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007779
Domain Number - Region: 187-266
Classification Level Classification E-value
Superfamily Major capsid protein VP5 0.0562
Family Major capsid protein VP5 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007779   Gene: ENSPANG00000005215   Transcript: ENSPANT00000022272
Sequence length 499
Comment pep:known_by_projection chromosome:PapAnu2.0:4:164713173:164733686:-1 gene:ENSPANG00000005215 transcript:ENSPANT00000022272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAAAPSRATREPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETS
SQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPGDLERRDLSHKE
KLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKE
YSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGK
YKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDG
DSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPK
RSVLSKSVPGYKPKAIPNALCGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTVEL
VSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDVCDRGYHTFCVGLGAIPSGRWICDCCQ
RAPPTPRKVGRRGKNSKEG
Download sequence
Identical sequences ENSPANP00000007779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]