SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007802 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007802
Domain Number 1 Region: 3388-3437
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000549
Family B-box zinc-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007802
Domain Number - Region: 3428-3542
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0262
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007802   Gene: ENSPANG00000006609   Transcript: ENSPANT00000010859
Sequence length 3651
Comment pep:known_by_projection chromosome:PapAnu2.0:6:73772232:73821172:1 gene:ENSPANG00000006609 transcript:ENSPANT00000010859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFHLDPQPRLSDQDEEGKIKQECIISDPSFSMVTVQREDSGITWETNSSRSSTPWASEE
SQTSGVCSREGSTVNSPPGNVSFIVDEVKKVRKRTHKSKHGSPSLRRKGNKKRNSFESQD
VPTNKKGSPLTSASQILTTEKEKSYTGVYDKARKKKTPSNTPPITGAIYKEHKPLVLRPV
YIGTVQYKIKMFNSVKEELIPLQFYGTLPKGYVIKEIHYRKGKDASISLEPDLDNSDSNT
VSKTSKLVAQSIEDKVKEVAPPWRGSISKGSESLTSMFSHEDQKKICADSPLNATSALEH
TVPSYSSSDRAEQGIQLRHSQSVPQQPEDEAKPHEVEPPSVTPGTPATVFLRTAKEECEL
ASPGTAASENDSSVSPSFTNEVKKEDVCSAHHSISLEAALPDLAASTEDGLDPDQEQPDL
TSLERAEPVSAKLTPTHPSVKGEKEENVLEPSISLSEPLMLEEPEKEEIDTSLPVAATPE
PEDSNLVEEEIIELDYPESPLVSEKPFPPHMSPEVEHEEEALILPLLATSTPEHVALSEE
EREEIASVSTDSAFVSEYSVPQDLNHELEKRESEPVSPSNVEAIAEHAVLSEEENEEFEA
YSPAAASASERSLSPSTTEMTLESQSPLFSTVTPEHMVLSGDEASESGRYTPDSTSASEY
SVPSQATKESLKKVIDHKSPLISKGVSEHMIPSEEKEDTGSFTLAVTSAAEPSLSPSTTE
KTSECQSPLPSTATSEHVVPSEGEDLGSECFTPDSKLISKYAAPLNATQEPQKKIIDAAS
QFKLKGISEHTVLSVEGKEDIGPASPDSVVASEHSFPPHTTEVTSECQAPPLSATPSEYV
VLSDEETVELERYTPSSTSASEFSVPPYATPEAQEEEIVHRSLNLKGASSPTNLSEEDQE
DIGPFSPDSAFASEFSFPPYATQEAEKREFECDSPICLTSPSEHTILSDEDTEEAELFSP
DSASQVSIPPFRISETEKNELEPDSLLTAVSASGYSCFSEADEEDIGSTAATPVSEQFSS
SQKQKSETFPLISPLEDLSLPPSTDKSEKAEIKPDIPTTSTSVSEYLILAQKQKTQAYLE
PESEDLIPPHLTSEVKKGEREASSSVTAIPASLPAQSSIVKEETKPASPHSVLPDSVPAI
KKEQEPTAALTLKAADEQMALSKVRKEEIVPDSQEATAHVSQDQKMEPQPPNIPGFEMKY
SVLPDVVDEPKKGVKPKLVLNVTSELEQRKLSENEPEVIKPCSPLKETSLSGPEVLSAAK
MEMKHDSKITTTPTVLHSASSGVEKQVKHGPHALAFSALSEEIKKEMEPSSSTTTASVTK
LDSNLTKVVKEEISTDSSLVTPVGHPVLTKVGKGELGSGLPPLVISTDEHSVLAEEDKVA
IKGASPIETSSKHLAWSEAEKEIKFDSPPSVSSIAEHSVLSEVEAKEVKAGLPVIKTSSS
QYSDESEEARVEDKQGLSCSTVRDSERLVSSQKKSLVSTSEVLGPEHELSLSLWGEIKKE
ETELPSSQNVSPASKHIIPKGKDEEIASSSPELENSASGLAPTLLLLSDDKNKQAVEVSS
TDQGDFPSEKQDIALAELSLEPEKKNKPHQLLELPNAGSEFASGLGRQSGSIGTKQAKSP
ITETGDSVLEKGPAELRSREGKEENRELYASATMPTTSELSSLLREESQNEETKPFSPKI
VSLELKEPPASVAEGDNPEEFQPFTFSLKGLSEEVSHPANFKKGGNQEIGPLPPTGNLKA
QVMGDIVAKLSEETGHPDSSQLLQSVTEPSKIALSDLLVEQKKTEKALHSDQTIKLADVS
TSFADKQDLDIKQFSFMKENLPLEQSKSFMTTKPADVKETKMEEFFISPKDENWMLGKPE
NVASQHEERIAGSVQLDSSGSNELRPEQLKAAVSSMDHIYEVRKQVLPHSAEESHLSSQE
AVSALDTSSGNVETLSCKSYSSEELKLAEEPKSFVLAGNVERNIAEEKESHSLMESESLL
LEKANTEFSWPSKEDSQEKIKLPPERFLQKPVSGLSVEQVKSETIPSSVKTTHFLAEGVE
PALGNEKEAHRSTPPFSGEKPLEESKMVQLKVIDDADEEKKPAPEVKIPTQRKPISSLHS
EEPQSPESPEVTEKPPTQPKVAKPDLPQEKGKKGISSFKSWMSSLFFGSSTPDRKVAEQE
DLETLPSPSVEKAVTVIEREGTIPTNFSVAEKQADHSLSEVKLKTADESRGTLVKSGEGQ
NVKEKSIILSNVEDLQQPKSISEVSREDYGKKEISDNSEEMNINSVVTSADGEKHLEIQP
YSLIGEKLIMEEAKTIVPLHVTDSKRVQKPAIAPPSKWNISIFKEEPRSDQKEKSLLSFD
VVDKVPQQPKSASSNFASKNITKESEKSESIILPVEESKGSLVDLSKDRLKKEMQNPTSL
KISEEETKLRSVSPTETKDNLENRSYTLAEKKVLAEKQDSVAPLELRDSNEIGKTQITHG
SRSTELEESKANAMPQHFYQNEDYSERPKIIVGSEKEKGEEKENQVYVLSEEKKKQEHQP
YSVNVAESMIKESDISLGHSLGETQSFSLVKATSVTEKSDAMLSDAHPEIREAKAVATQP
HPLEESKVLVEKTKTFLPVALPCRDEIENHSLSQEGNLVLEKSSRDMPDHSEEKEQFRES
ELSKGGSVDITKESMKQGFPTKESERTLAYPFDETKSSETPPYLLSSVKPQTLVSGASPE
INAMKKQEMPQSELTPERHTVHTLQTSKDDTFDVPKQSVLVSKHHLEAVEDTHVKEPLSS
AKSNYAQFIYSASASNADKMVSNKEMSKEPEDTYAKGEDFTVTSKPAGLSEDQKTAFSII
SEGCEILNIHAPAFISSIDQEESEQMQDKLEYLEEKASLKTVPLRDDSETVACHKTLKSR
LEDSDEKVTSLKETKQKETHHTEEKTSTDSETGDLSFIQSTIPSEEDYFEKYTLIDYNIS
PDPEKQKAPQKLNVEDKLSEEVTEEAISFPVSSVESALEHEYGLVKLDESFYGPEKDHDI
LSHPETQKSLGIQKSADRNVSKDVKRDVDSKSLGMPLFEAEEGVLSRTQIFPTTIKAINP
ELLEEPPALAFLYKDLYEEAVGEKKKEEETASEGDSVNSEASFPSRNSDTDDGTGIYFEK
YILKDDILHDTSLTQKDQGQGLEEKRVGRDDSYQPIAAEGEIWGKFGTICREKSLEEQKG
VYGEGESVGHVETLGNIAMQKKAPIREDIRVATQKISYAVPFEDTHHVLEHADEAGSQGN
EVENASPEVSLNVPVQVSFPEEEFASGATHVQETPLEEPKILVPPEPSEERLRSSPVQDE
YEFAESLHYEVLPQDILSEELSSESRPEDVLSQGKESFEHISENEFVSETEQSTSAEQKE
LGSEWKEENQLSSELVTEKAQKELKKSQIDTYCYTCKCPISATDKVFGTHKDHEVSTLDT
AISAVKVQLAEFLENLQEKSLRIEAFVSEIESFFNTIEENCSKNEKRLEEQNEEMMKKVL
AQYDEKAQSFEEVKKKKMEFLHEQMVHFLQSMDTAKDTLETIVREAEELDEAVFLTSFEE
INERLLSAMESTASLEKMPAAFSLFEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATS
TTIAVYWSMNKDDVVDSFQVYCMEEPQDDQEVNGRIANTNTNAYAYSGIFM
Download sequence
Identical sequences ENSPANP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]