SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007830 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007830
Domain Number 1 Region: 326-381
Classification Level Classification E-value
Superfamily CCCH zinc finger 4.58e-20
Family CCCH zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 298-324
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000034
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 271-295
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000196
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007830   Gene: ENSPANG00000025224   Transcript: ENSPANT00000010592
Sequence length 1186
Comment pep:known_by_projection chromosome:PapAnu2.0:13:103089818:103122738:1 gene:ENSPANG00000025224 transcript:ENSPANT00000010592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STVFIHAFIFREDGELEDGEIDDAGLSSIKSAKTKDGLEKNRAFPYKSIAKKCQRDNEEN
VIKFLSREKPQHNSPSSDDSSDYSLDSDVEHTESSHKKRTGFYRDYDIPFTQRAHISGSY
MTSKKGQHKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETS
NIALGSSFSKESGKKQRMKGVQQGIEQRVKSFNVGRGRGLPKKIKRKERGGRTNKGPNVF
VSDDFQEYSKPGKKWKVMTQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAELEK
RKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHDDLTKETKKLLDK
VLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFSDD
FRKIPSLFEIVVKPTVDLAHKIGRKPPAFYNSASPPGPQFQGSSPHSQHIYSSGSSPGPG
PNMSQGHSSPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGVLVQPDTSL
TPPNMGGAYHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDNYY
AQHPVHNFQPPSNSGDGMWHGEFAQQQPPIVQDSPNHGSGSDGSSTRTGHGPLPVPGLLP
AVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEEDDTVNWYSSSEEEEGSSVKSILKTLQK
QTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRKPSESAPLDLRLA
WDPRKLRGNGSGHVGSSVSGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIPLD
ASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINLPL
PPLIADQRLNRLWNTKSDLHQNTVSIDPKLAAKAKINTTSREGYLEQFGDSHSSGSKLGD
PRLQNFDPRLHRLANTESHQVVMKDSHTSKGAPHLARPNPGSSQPSGAGASNSGSGALPP
YVPKLSSSAGLPLGTSTSVLSGISLYDPRDHGSSSTSELATASSGENSKNQKKSGGLKSS
DKNEPSPGEAILPQKTSPNVEVTLDGPADPQADVPRSSGKVQVPAVHSLPVQALTGLIRP
QYSDPRQARQPGQGSPIPDNDPGRETDDKSLKEVFKTFDPTASPFC
Download sequence
Identical sequences ENSPANP00000007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]