SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007833 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007833
Domain Number 1 Region: 21-185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.14e-23
Family Synaptotagmin-like (S variant) 0.073
Further Details:      
 
Domain Number 2 Region: 618-648
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.000000000732
Family Eferin C-derminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007833   Gene: ENSPANG00000025001   Transcript: ENSPANT00000027052
Sequence length 655
Comment pep:known_by_projection chromosome:PapAnu2.0:13:72011837:72047951:-1 gene:ENSPANG00000025001 transcript:ENSPANT00000027052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVV
EKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGV
DKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDL
SMKDKPRSPFSKIKDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKL
RKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSTEGGRDSAQSPKLF
THKRTYSDEASQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGPVRHRSSISG
SLPSSGSLQAVCSRLSEEGPRSTDDSWPRGSRSNSSSEAVLGQEEPSAQAKVLAPGASHP
GEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRR
SSLGEKGGPTLGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPD
RKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKKLKDSAVLDQSAKYYHL
THDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQRSPGSFPPA
Download sequence
Identical sequences ENSPANP00000007833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]