SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007835 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007835
Domain Number 1 Region: 225-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily LCCL domain 2.75e-25
Family LCCL domain 0.00082
Further Details:      
 
Domain Number 3 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-25
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007835   Gene: ENSPANG00000017288   Transcript: ENSPANT00000005616
Sequence length 678
Comment pep:known_by_projection chromosome:PapAnu2.0:4:144969427:145018559:-1 gene:ENSPANG00000017288 transcript:ENSPANT00000005616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASD
YLLFTSSSDQYGPYCGSMTVPRELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLIT
CLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQI
SVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSLDPDGQIRASSSWQSVN
ESGDQVHWSPGQARLQDQGPSWASGDSSSNHKPREWLEIDLGEKKKITGIRTTGSTQSNF
NFYVKSFVMNFKNNNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQ
TWHQRIALKVELIGCQITQGNDSLVWRKTSQSTSVSSKKEDETITRPVPSEETSPGINIT
TVAIPLVLLVVLVFAGMGIFAAFRKKKKKGSPYGSAEAQKTDCWKQIKYPFARHQSAEFT
ISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRPMDTDTEESGAGTDAGGH
YDCPQRAGRHEYALPLAPPEPEYATPIVERHLLRAHTFSAQSGYRVPGPQPGHKHSLSSG
GFSPVAGVGAHDGDYQRPQSVQPADRGYDRPKAASAFATESGHPDSQKPPTHPGTSDSYS
APRDCLTPLNQTAMTALL
Download sequence
Identical sequences ENSPANP00000007835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]