SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007839 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007839
Domain Number 1 Region: 546-736,828-1149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.4e-71
Family Tandem AAA-ATPase domain 0.035
Further Details:      
 
Domain Number 2 Region: 301-325
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000314
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number 3 Region: 171-221
Classification Level Classification E-value
Superfamily UBA-like 0.00000351
Family UBA domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007839
Domain Number - Region: 338-420
Classification Level Classification E-value
Superfamily UBC-like 0.00934
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007839   Gene: ENSPANG00000024244   Transcript: ENSPANT00000026842
Sequence length 1400
Comment pep:known_by_projection chromosome:PapAnu2.0:13:37755029:37846631:-1 gene:ENSPANG00000024244 transcript:ENSPANT00000026842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVRRKGKPGKGGGKGSSRGGRGGRSHASKSHGSGSSGGGGGGGGGGGNRKASSRIWD
DGDDFCIFSESRRPSRPSNSNISKGEARPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQ
EQDADAGSERGISWEEEDDEPDCCNDERYWPAGQEPSLVPDLDPLEYAGLAPVEPHVPEF
TVSPFAVQKLSRYGFNIERCQAVLRMCDGDVGASLEQLLTQCFSETFGERMKISEAVNQI
SLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLTSRFRKSKPKESTKNVQE
NSLEICKFYLKGNCKFGSKCKFKHEVPPNQIVGRIERSVDDSHLNANEDGSFLYELEIRF
SKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAETSEPVVYSLITLLEEES
EIIKLLTNTHHKYSVPPVNVLPVPSRTRINNPACHKPVIPNNSFVSNQIPEVEKESESEE
SDEDEGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKICKQFRMKQASRQFQSILQ
ERQSLPAWEERETILNLLRKHQVVVISGMTGCGKTTQIPQFILDDSLNGPPEKVANIICT
QPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDTAL
QGVSHIIVDEVHERTEESDFLLLVLKDIVSQRPGLQVILMSATLNAELFSEYFNSCPVIT
IPGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRL
SLHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIV
DGKHSYPPGAILVFLPGLAEIKMLYEQLQCNSLFNNRRSNRCVIHPLHSSLSSEEQQAVF
VKPPVGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDASKGMESLEDTFVSQANAL
QRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSAHNLQS
VFSRLIEPPHADSLRASKIRLRDLGALTPDEKLTPLGYHLASLPVDVRIGKLMLFGSIFR
CLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFAFANSDYLALLQAYKGWQLSTREGV
RAGYNYCRQNFLSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDAT
GEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVRMQPKSAELKFVTKND
GYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQR
GEFVVSLDDGWIRFVAASHQILWAVRFAVSRREQMYQLLPHSMVPFIHSFNSLHSMSHNS
GHRHAAIFKEVHKDDTLEEK
Download sequence
Identical sequences ENSPANP00000007839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]