SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007844 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007844
Domain Number 1 Region: 606-721
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000233
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007844
Domain Number - Region: 204-377
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00445
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 
Domain Number - Region: 976-1053
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00706
Family Regulator of chromosome condensation RCC1 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007844   Gene: ENSPANG00000020539   Transcript: ENSPANT00000005712
Sequence length 1161
Comment pep:known_by_projection chromosome:PapAnu2.0:3:39494625:39526867:-1 gene:ENSPANG00000020539 transcript:ENSPANT00000005712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNSVLWAVDLFGRVYTLSTAGQYWELCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCA
SDVPIRRREEAYENQRWNPVGGFCEKLLLSDRWAWSDVSGLQHRPLDGVALPSPHWEWES
DWYVDENFGGEPTEKGGWTYAIDFPATYTRDKKWNSCVRRRKWIRYRRYKSRDIWAKIPS
KDDPKELPDPFNDLSGGWEITEEPVGRLSVWAVSLQGKVWYREDVSHSNPEGSSWSLLDT
PGEVVQISCGPHDLLWATLWEGQALVREGINRSNPKGSSWSVVEPPGSENGVMHVSVGVN
VVWAVTKDQKVWFRRGVNSHNPCGTSWIEMVGEMLMVNVGMNDQVWGIGCEDRAVYFRQG
VTPSELSGKTWKAIVAARECDRSHSGSSSSLLSAGCFFGDEVRGSGESAPSDTDASSEVE
RPGPGQPLPAEPLDDSKNPTGSSASGPGAGRTAEDTTEDACPAEGSGAARPDTHPGPAPT
PAELPWTNIDLKEPKKVPSHSAAGFPETTSLSSLGLLPLGLEEPYGVDDHPLWAWVSGGG
CVVEACAMPRWFTVQAGLSPSVQTLSLSITPAQTAAWRKQIFQQLTERTKRELENFRHYE
QAVEQSVWVKTGALQWWCDWKPHKWVDVRVALEQFTGHDGARDSILFIYYVVHEEKKYAH
IFLNEVVALVPVLNETKHSFALYTPERTRQRWPVRLAAATEQDMNDWLALLSLSCCESRK
VQGRPSPQAIWSITCKGDIFVSEPSPDLEHPLPCDQMFWRQMGGHLQMVEANSQGVVWGI
GYDHTAWVYTGGYGGGCFQGLASSTSNIYTQSDVKCVHIYENQRWNPVTGYTSRGLPTDR
YMWSDASGLQECTKAGTKPPSLQWAWVSDWFVDFSVPGGTDQEGWQYASDFPASYHGSKT
MKDFVRRRCWARKCKLVTSGPWLEVPPIALRDVSIIPESPDAERSGHSIALWAISDKGDV
LCRLGVSALNPAGSSWLHVGTDQPFASISIGACYQVWAVARDGSAFYRGSVYPSQPAGDC
WYHIPSPPRQRLKQVSVGQTSVYALDENGNLWYRQGITPSYPQGSSWEHVSNNVCRVSVG
PLDQVWVIANKVQGSHSLSRGTVCHRTGVQPHEPKGHGWDYGIGGGWDHISVRANATRAP
RSSSQEQEPSAPPEAHGPVCC
Download sequence
Identical sequences ENSPANP00000007844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]