SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007847 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007847
Domain Number - Region: 528-576
Classification Level Classification E-value
Superfamily EF-hand 0.0204
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007847   Gene: ENSPANG00000024774   Transcript: ENSPANT00000016040
Sequence length 712
Comment pep:known_by_projection chromosome:PapAnu2.0:20:50032468:50054231:1 gene:ENSPANG00000024774 transcript:ENSPANT00000016040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACQQSRYRSFSSASRLQPQPSGVTIDESFITENKSTQKCKLLQKRRTLTGQFSMGGHLS
PWPTYTSGQTILQNRKPCSDDYRKRVGSCQQHPFRTAKPRYLEELENYLRKELLLLDLGT
DSTQELRLQPYREIFEFFIEDFKTYKPLLSSIKNAYEGMLAHQREKIRALEPLKAKLVTM
NEDCNERILAMRAEEKHEISLLKKEKMNLLKLIDKKNEEKISLQSEVAKLRKNLAEEYLH
YLSERDARKILIADLNELRYQREDMSLAQSPGIWGEDPVKLTLALKMTRQDLTRTQMELN
TMKANFGDVVPRRDFEMQEKTNKDLQEQLDTLRASYEEVHKEHEILMQLHMSTLKERDQF
FSELQEIQRTSTPRPDWTKCEDVVAGGPERWQMLAEGKNSDQLVDVLLEEIGSGLLREKE
FFPGLGYGEAIPAFLRFDGLVENKKPSKKDVVDLLKDAWKERLAEEQKETFPDFFFNFLE
RRFGPSDAMAWAYTIFENIKIFHSNELMSQFYAVLMGKRSENVYVTQKETVAQLLKEMTN
ADSQNEGLLTMEQFNTVLKSTFPLKTEEQIQELMEAGGWHPSSSNADLLNYRSLFMEDEE
GQSEPFVQKLWEQYMDEKDEYLLQLKQELGIELHEEVTLPKLRGALMTIDPSLDKQTVNT
YMSQAFQLPESELPEDSDEKEEGVVEILQTALERLQVIDIRRAGPREPEPAN
Download sequence
Identical sequences A0A096N5X4
ENSPANP00000007847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]