SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007857 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007857
Domain Number 1 Region: 405-518
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-17
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 210-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000742
Family Calmodulin-like 0.065
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007857
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00439
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007857   Gene: ENSPANG00000012123   Transcript: ENSPANT00000026656
Sequence length 534
Comment pep:known_by_projection chromosome:PapAnu2.0:19:10390800:10406195:1 gene:ENSPANG00000012123 transcript:ENSPANT00000026656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGIVCENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVETLRTVK
EEAEKPEKEAKEQHQRLWEEQLAATKVQREQALAADAFQELDDDMDGTVSVTELQTHPEL
DTDGDGVLSEAEAQALLSGDTQTDASSFFDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSPPTEEEEEEEEEEEAEEEEEEEEDSEVQGEQPKEALLPLAPPQPASPAEED
KMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQ
CYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPEHDRFSAMKYEQGTGCWQG
PNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACLEPPPEAPTEDDHDEL
Download sequence
Identical sequences A0A0A0MVU7
ENSPANP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]