SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007870 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007870
Domain Number 1 Region: 284-418
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.26e-32
Family Synaptotagmin-like (S variant) 0.00023
Further Details:      
 
Domain Number 2 Region: 147-279
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.41e-17
Family Synaptotagmin-like (S variant) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007870   Gene: ENSPANG00000004416   Transcript: ENSPANT00000025153
Sequence length 421
Comment pep:known_by_projection chromosome:PapAnu2.0:14:7053819:7081361:-1 gene:ENSPANG00000004416 transcript:ENSPANT00000025153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDVAEYHLSVIKSPPGWEVGVYAAGALALLGIAAVSLWKLWTSGSFPSPSPFPNYDYR
YLQQKYGESCAEARQKRVPAWNAQRASTRGSSSRKGSLSIEDTFESISELGPLELMGREL
DLAHCGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMEYDAASHTLHVAVLQGKDLL
EQEEASFESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVF
GIDEDERNVSTGVVELKLSVLDLLLQPFSGWLYLQDQNKAADAVGEILLSLSYLPTAERL
TVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPA
IVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLTTLRRPVSMWHAVRR
N
Download sequence
Identical sequences A0A096N5Y7
ENSPANP00000007870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]