SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007872 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007872
Domain Number 1 Region: 330-354
Classification Level Classification E-value
Superfamily Notch domain 0.0000615
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007872
Domain Number - Region: 859-931
Classification Level Classification E-value
Superfamily EF-hand 0.00309
Family Parvalbumin 0.071
Further Details:      
 
Domain Number - Region: 393-420
Classification Level Classification E-value
Superfamily Notch domain 0.00445
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007872   Gene: ENSPANG00000000420   Transcript: ENSPANT00000024213
Sequence length 1141
Comment pep:known_by_projection chromosome:PapAnu2.0:11:101063959:101104947:-1 gene:ENSPANG00000000420 transcript:ENSPANT00000024213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVFLSSEKQLECLLTHCIKVPMLVLDPALPASITLKDLPSLYPSFHSASDKFNVAKPKN
PSTNVSVVVFDSTKDVEDAHSGLLKGNNRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPP
TFKETNQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKNFQELNKQTKKNMTIDGKEL
TISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIEKHAPWVRNIFIVTNGQIP
SWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDV
WPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGS
RYIAGGGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDC
GQDHFHELYKVTLLPNQTHYIIPKGECLPYFSFAEIAKRGVEGAYSDNPIIRHASIANKW
KTIHLIMHSGMNATTIHFNLTFQNRNDEEFKIQITVEVDTREGPKLNSTAQKGYENLVSP
TTLLPEAEILFEDIPKEKRFPKFRRHDVNSTRRAQEEVKIPLVNISLLPKEAQLSLNKLD
LQLEHGDITMKGYNLSKSALLRSFLMNSQHAKVKNQAIITDETNDSLVTPQEKQVHQSIL
PNSLGVSERLQRLTFPAVSVKVNGHDQGQNLPLDLETTARFRSETHTQKTVGGNVTKEKL
SSLIVPLASQMTKEKKITGKEKENNRMEENAENHIGVTEVLLGRKLQHYTESYLGFLPWE
KKKYFQDLLDEEESLKTQLAYFTDSKNTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPA
HMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFD
EVDTDQSGVLSDREIRTLATRIHELPLSLQDLTGLEHMLINCSKMLPADITQLNNIPPTQ
EAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVG
QLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHM
HELQEWRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEASPNRIR
V
Download sequence
Identical sequences ENSPANP00000007872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]