SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007886 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007886
Domain Number 1 Region: 107-198
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000109
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007886   Gene: ENSPANG00000022966   Transcript: ENSPANT00000008084
Sequence length 342
Comment pep:novel chromosome:PapAnu2.0:1:83737370:83738441:1 gene:ENSPANG00000022966 transcript:ENSPANT00000008084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRKVNELQALVKIRKQDLSILHAEEMRFLRKGVESGGKVLPATQKSKSEENTKDSKKV
QEDLKTDKPSSEESDLEIDNECVIKPDTDAPQEMGDENAEVTEEMDQANDKKVAAIEALN
DGELQKAIDLFTNTIKLNLHLAILYAKRVSVFVKLKKPNAAIRDCDTGIEINPDSAQPYK
WQVKAHRLLGHWEDAHDLALACKLFYDEDTSTMLKEIQPRAQEIAEERRAREQRTERVKT
AGEERERTREEEEARPQDGSFPGGFPGGMPGNFPGGMSGRTQMPGLNEILSDPEVLADTQ
DPEVMVAFQDVAQNPANTSKYQRNPKVMNLISKLSANWRSSI
Download sequence
Identical sequences ENSPANP00000007886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]