SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007887 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007887
Domain Number 1 Region: 4-168,251-292
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-31
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 180-269
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.59e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007887   Gene: ENSPANG00000015000   Transcript: ENSPANT00000005203
Sequence length 297
Comment pep:known_by_projection chromosome:PapAnu2.0:17:29853663:30029391:1 gene:ENSPANG00000015000 transcript:ENSPANT00000005203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQF
DVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSV
IMWDIGGRKGTAIELQGHNDKVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLD
SDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRV
CDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Download sequence
Identical sequences ENSPANP00000007887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]