SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007898 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007898
Domain Number 1 Region: 187-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-86
Family Protein kinases, catalytic subunit 0.00000000000288
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.58e-41
Family Regulator of G-protein signaling, RGS 0.0000000519
Further Details:      
 
Domain Number 3 Region: 554-664
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007898   Gene: ENSPANG00000024198   Transcript: ENSPANT00000000624
Sequence length 689
Comment pep:known_by_projection chromosome:PapAnu2.0:14:6802057:6825083:-1 gene:ENSPANG00000024198 transcript:ENSPANT00000000624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences A0A096N611 A0A0D9R809 A0A2K5L0Z3 A0A2K5QMM1 A0A2K6PMB5 H2NCP1 H9FQI5
ENSPPYP00000003477 9600.ENSPPYP00000003477 XP_002821498.1.23681 XP_007966817.1.81039 XP_010364666.1.97406 XP_011896875.1.92194 XP_017392853.1.71028 ENSPANP00000007898 ENSPPYP00000003477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]