SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007910 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007910
Domain Number 1 Region: 6-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-46
Family Glutathione peroxidase-like 0.000000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007910   Gene: ENSPANG00000009811   Transcript: ENSPANT00000005941
Sequence length 168
Comment pep:novel chromosome:PapAnu2.0:5:176860229:176861320:1 gene:ENSPANG00000009811 transcript:ENSPANT00000005941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATPRGWLLGDVAPNFEANTTASRVRFHDFLGNSWGFLSSHPQDFTPVCSTELSRAAKLAS
EFAKRNVKLIALSIDSVEDHLAWSKDINAYNGEEPTEKLPFPIFDDKNRDLTIVLGMLDP
AEKDEKDMPAAARVVFVIGPDKKLKLSIIYPATIGGNFDEILPIVTSP
Download sequence
Identical sequences ENSPANP00000007910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]