SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007912 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007912
Domain Number - Region: 103-134
Classification Level Classification E-value
Superfamily EF-hand 0.1
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007912   Gene: ENSPANG00000000987   Transcript: ENSPANT00000016775
Sequence length 660
Comment pep:known_by_projection chromosome:PapAnu2.0:2:91869897:92119056:1 gene:ENSPANG00000000987 transcript:ENSPANT00000016775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTLSALNTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKEDGGAQLLFRPLLNKYE
QETLENQNLYLVGASKIRMLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLT
MAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDNEALK
KLEDSWYTRFALKYQPIDRIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILEVWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINPITGK
EEPLYPSYKRQLRIYLVSLPFVCLCLYFSLYVMMIYFDLEVWALGLHENSGSEWTSVLLY
VPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHLILKVLVFNFLNCFASLFYIA
FVLKDMKLLRQSLATLLITSQILNQIVESLLPYWLQRKHGVRVKRKMQALKTDSDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRV
FKRPFSEPSASIGVWQLAFETMSVISVVTNCALIGMSPQVNAIFPESKADLILIVVAVEH
ALLALKFILAFAIPDKPRHIQVKLARLEFESLEALKQQQMKLVTENLKEEPKESGKEKAT
Download sequence
Identical sequences A0A096N625
ENSPANP00000007912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]