SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007915 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007915
Domain Number 1 Region: 231-389
Classification Level Classification E-value
Superfamily TPR-like 2.35e-21
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007915
Domain Number - Region: 61-205
Classification Level Classification E-value
Superfamily TPR-like 0.0184
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007915   Gene: ENSPANG00000004758   Transcript: ENSPANT00000016167
Sequence length 475
Comment pep:known_by_projection chromosome:PapAnu2.0:5:136725649:136981433:-1 gene:ENSPANG00000004758 transcript:ENSPANT00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLPPLPMTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAY
RNSYKKNICVDMLRDGYHKSFTELFALMEQWDALREAARVRSLFWLQKPLEEQPDKLDYF
YHYLTRAEDAERKKSFEDVYNNLYALACYFNNPEDKWVRNHFYERCFKIAQLIKIDGGKK
EAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLL
SDKMLQNKEYKQAIKILIKASEIAKEGSDKKMEGEASYYLGLAHLAAEEYETALTVLDTY
CKISTELDDDLSLGRAYEAIAKVLQSQGNTTEAITYLKKFVKIARNNFQSLDFVRASTML
GDIYNEKGHYNKASQRFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESAD
LTSLNYLLSWKESRGDIEPDPVTEEFRGSTVETVSQNSEHLEELSRFPGDQKNET
Download sequence
Identical sequences A0A096N628
ENSPANP00000007915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]