SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007944 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007944
Domain Number 1 Region: 20-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.35e-56
Family G proteins 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007944   Gene: ENSPANG00000021075   Transcript: ENSPANT00000004899
Sequence length 215
Comment pep:known_by_projection chromosome:PapAnu2.0:11:51560231:51565835:1 gene:ENSPANG00000021075 transcript:ENSPANT00000004899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGTACRSRGVDLHEQSQQNKSQCCSN
Download sequence
Identical sequences A0A0D9QZ02 A0A2K5YY97 A0A2K6APS0 A0A2K6JUQ8 A0A2K6QHW7 G7N7A8 G7PIG1
XP_004466144.1.11602 XP_008001772.1.81039 XP_010376126.1.97406 XP_011726938.1.29376 XP_011825391.1.47321 XP_011899427.1.92194 XP_012383577.1.11602 XP_015007425.1.72884 XP_017708823.1.44346 ENSPANP00000007944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]