SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007950 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007950
Domain Number 1 Region: 297-619
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.51e-89
Family p120GAP domain-like 0.0000787
Further Details:      
 
Domain Number 2 Region: 577-713
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-47
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-26
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 4 Region: 14-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-24
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007950   Gene: ENSPANG00000013357   Transcript: ENSPANT00000022077
Sequence length 834
Comment pep:known_by_projection chromosome:PapAnu2.0:17:90587169:90721211:-1 gene:ENSPANG00000013357 transcript:ENSPANT00000022077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEA
KKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEEDVDKLEIRVDLWNASNLKFGD
EFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYY
SPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLLLHYGRVVPFISAIASAEV
KRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG
ENLENNMENLRQYVDRIFHAITESGVSCPTVMCDIFFSLREAAAKRFQGDPDVRYTAVSS
FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMAT
FYEFFNEQKYADAVKNFLDLISSSGRRDPKSVEQPILLKEGLMIKRAQGRKRFGMKNFKK
RWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQAN
NCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPANI
QLDIDGDRETERIYSLFNSYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTL
KQIIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
Download sequence
Identical sequences ENSPANP00000007950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]