SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007952 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007952
Domain Number 1 Region: 449-721
Classification Level Classification E-value
Superfamily TPR-like 2.31e-44
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007952   Gene: ENSPANG00000024152   Transcript: ENSPANT00000005245
Sequence length 741
Comment pep:known_by_projection chromosome:PapAnu2.0:17:77935432:78013172:-1 gene:ENSPANG00000024152 transcript:ENSPANT00000005245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLDTDLDHIFPSSVLPPLWAKLVVGLVAIVCFARSYDGDFVFDDSEAIVNNKDLQAET
PLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHGGISV
LMVDVFSVLFGGLQYTSKGRRLHLAPRASLLAALLFAVHPVHTECVAGVVGRADLLCALF
FLLSFLGYCKAFRESNKEGTYSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIG
KFNVLEIVQKVLHKDKSLESLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPPAFTE
VDNPASFADGMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVSDWRVIALAA
LWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVG
YCVLLTFGFGALSKHTKKKKLIAAVVLGILLINMLRCVVRSGQWRSEEQLFRSALSVCPL
NAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLS
LAVRIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRMAIKHRRKYPDCYYNLGRLYADLNRH
VDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLAN
VLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTAS
GTKENYGLLRRKLELMQKKDV
Download sequence
Identical sequences A0A096N665
ENSPANP00000007952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]