SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007967 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007967
Domain Number 1 Region: 87-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.78e-21
Family Cold shock DNA-binding domain-like 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007967   Gene: ENSPANG00000010280   Transcript: ENSPANT00000019060
Sequence length 372
Comment pep:known_by_projection chromosome:PapAnu2.0:11:10380990:10403566:-1 gene:ENSPANG00000010280 transcript:ENSPANT00000019060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDA
APAATGTAAATSLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQ
TAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRG
YYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPY
HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGTQLQGPVHRNPTYRPRYRSRGPPRPR
PAPAVGEAEDKENQQASSGPNQPSVRRGYRRPYNYRRRPRLPNAPSQDGKEAKAGEAPTE
NPAPPTQQSSAE
Download sequence
Identical sequences A0A096N674
ENSPANP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]